P21 Peptide

Price range: $350.00 through $850.00

P21 Peptide: Chemical Composition & Structure

Molecular Formula:

C₇₇₅H₁₂₃₉N₂₂₃O₂₃₉S₉

Molecular Weight:

18,118.9 g/mol

Amino Acid Sequence:

MAEPKGGPEAAPVKKRRVGPKSVKQKKKPPSGKAGLEPGGGAAGPAGAQCAAPAPAPAPAPASPAASPAAPAPAPAPAPAAAPAPAPAPAPAPAPAPSQTSGVRAPIRTIQTAQHPPVDINTMSDILDWLVQEHYPFWPGAAEDFFVGNDKPVAPSDGVIKWEDNLSWTAQDILGSDF

Key Structural Features:

164-amino acid protein – Full-length p21 peptide
N-terminal CDK-binding domain – Critical for CDK inhibition (amino acids 1-80)
C-terminal PCNA-binding domain – Mediates interaction with proliferating cell nuclear antigen (PCNA) (amino acids 140-164)
Disordered regions – Flexible structure for protein-protein interactions
Phosphorylation sites – Multiple serine and threonine residues for post-translational regulation

Chemical Properties:

Property	Details
Solubility	Water-soluble (reconstitute with sterile buffer)
Storage (Lyophilized)	-20°C (stable for 2+ years)
Storage (Reconstituted)	-80°C (stable for 6-12 months)
Half-Life	~2-4 hours (in vitro), ~6-12 hours (in vivo)
Purity	≥95% (HPLC-verified)

Choose An Option

Clear

SKU: N/A Categories: Healing & Recovery Peptides, Anti-Aging & Longevity Research Peptides, Cognitive & Neurological Research Peptides, Experimental Research Peptides Tags: p021, p021 peptide, p21, p21 peptide

P21 Peptide: A Comprehensive Research Guide to Cell Cycle Control & Oncology

Introduction to P21 Peptide

P21 (also known as CDKN1A, Cip1, or Waf1) is a critical cell cycle regulatory protein that functions as a cyclin-dependent kinase inhibitor (CKI). This 21 kDa peptide plays a pivotal role in controlling cell proliferation, DNA damage response, and tumor suppression. As a key downstream effector of p53, p21 is essential for maintaining genomic stability and preventing uncontrolled cell division.

At Wholesale China Peptides, researchers can access high-purity p21 peptide for controlled laboratory studies. This 1000+ word guide covers everything scientists need to know about p21 peptide, including its chemical composition, mechanisms of action, research benefits, dosage protocols, and safety considerations.

What Is P21 Peptide?

P21 is a 164-amino acid protein that inhibits cyclin-dependent kinases (CDKs), particularly CDK2, CDK1, and CDK4/6, which are essential for cell cycle progression. By binding to and inhibiting these kinases, p21 arrests the cell cycle at the G1/S and G2/M checkpoints, allowing for DNA repair or apoptosis in response to cellular stress or damage.

Key Features of P21 Peptide:

✅ Cell cycle regulation – Arrests cell division at critical checkpoints
✅ Tumor suppression – Prevents uncontrolled cell proliferation in cancer
✅ DNA damage response – Mediates p53-dependent cell cycle arrest
✅ Senescence induction – Promotes cellular senescence in response to stress
✅ Apoptosis modulation – Regulates programmed cell death in damaged cells
✅ Stem cell differentiation – Influences stem cell fate decisions

P21 Peptide Benefits in Research

P21 is studied for its potential therapeutic applications in multiple fields:

1. Cancer Research & Oncology

Tumor suppression – Inhibits cancer cell proliferation and induces cell cycle arrest
Chemotherapy sensitization – Enhances efficacy of DNA-damaging agents
Radiation therapy enhancement – Improves response to radiation treatment
Metastasis prevention – Reduces cancer cell migration and invasion
Cancer stem cell targeting – Inhibits self-renewal of cancer stem cells

2. Cell Cycle & DNA Damage Research

Cell cycle regulation – Studies G1/S and G2/M checkpoints
DNA damage response – Investigates p53-p21 pathway activation
Genomic stability – Explores p21’s role in maintaining DNA integrity
Replication stress – Studies p21’s response to DNA replication errors

3. Aging & Senescence Research

Cellular senescence – Investigates p21’s role in aging and age-related diseases
Telomere dysfunction – Studies p21’s response to telomere shortening
Oxidative stress – Explores p21’s role in oxidative damage response
Lifespan extension – Investigates p21’s impact on longevity

4. Stem Cell & Regenerative Medicine

Stem cell differentiation – Studies p21’s role in cell fate decisions
Tissue regeneration – Explores p21’s effects on wound healing and repair
Induced pluripotent stem cells (iPSCs) – Investigates p21’s role in reprogramming
Organoid development – Studies p21’s effects on 3D tissue models

5. Neurodegenerative Disease Research

Alzheimer’s disease – Explores p21’s role in neuronal cell cycle re-entry
Parkinson’s disease – Investigates p21’s effects on dopaminergic neurons
Stroke and brain injury – Studies p21’s role in neuronal repair
Neurogenesis – Explores p21’s effects on neural stem cells

P21 Peptide: Chemical Composition & Structure

Molecular Formula:

C₇₇₅H₁₂₃₉N₂₂₃O₂₃₉S₉

Molecular Weight:

18,118.9 g/mol

Amino Acid Sequence:

MAEPKGGPEAAPVKKRRVGPKSVKQKKKPPSGKAGLEPGGGAAGPAGAQCAAPAPAPAPAPASPAASPAAPAPAPAPAPAAAPAPAPAPAPAPAPAPSQTSGVRAPIRTIQTAQHPPVDINTMSDILDWLVQEHYPFWPGAAEDFFVGNDKPVAPSDGVIKWEDNLSWTAQDILGSDF

Key Structural Features:

164-amino acid protein – Full-length p21 peptide
N-terminal CDK-binding domain – Critical for CDK inhibition (amino acids 1-80)
C-terminal PCNA-binding domain – Mediates interaction with proliferating cell nuclear antigen (PCNA) (amino acids 140-164)
Disordered regions – Flexible structure for protein-protein interactions
Phosphorylation sites – Multiple serine and threonine residues for post-translational regulation

Chemical Properties:

Property	Details
Solubility	Water-soluble (reconstitute with sterile buffer)
Storage (Lyophilized)	-20°C (stable for 2+ years)
Storage (Reconstituted)	-80°C (stable for 6-12 months)
Half-Life	~2-4 hours (in vitro), ~6-12 hours (in vivo)
Purity	≥95% (HPLC-verified)

How P21 Peptide Works: Mechanisms of Action

P21 exerts its effects through multiple molecular pathways, primarily by inhibiting cyclin-dependent kinases (CDKs) and interacting with other cell cycle regulators.

1. Cell Cycle Arrest

CDK inhibition – P21 binds to and inhibits CDK2, CDK1, and CDK4/6
Cyclin-CDK complex disruption – Prevents phosphorylation of retinoblastoma protein (Rb)
E2F transcription factor inhibition – Blocks S-phase gene expression
Cell cycle arrest – Halts progression at G1/S or G2/M checkpoints

2. DNA Damage Response

p53 activation – DNA damage induces p53, which transactivates p21
Cell cycle arrest – P21 halts cell cycle to allow DNA repair
Apoptosis regulation – P21 modulates p53-dependent apoptosis
Senescence induction – Prolonged p21 activation leads to cellular senescence

3. Tumor Suppression

Oncogene-induced senescence – P21 prevents transformation by oncogenes
Metastasis inhibition – P21 reduces cancer cell migration and invasion
Chemotherapy sensitization – P21 enhances efficacy of DNA-damaging drugs
Radiation therapy enhancement – P21 improves response to ionizing radiation

4. Stem Cell Regulation

Differentiation induction – P21 promotes stem cell differentiation
Self-renewal inhibition – P21 reduces stem cell proliferation
Reprogramming modulation – P21 influences induced pluripotent stem cell (iPSC) generation

5. Neuroprotection

Neuronal cell cycle control – P21 prevents aberrant cell cycle re-entry in neurons
Neurodegeneration prevention – P21 protects against Alzheimer’s and Parkinson’s pathology
Neurogenesis regulation – P21 influences neural stem cell fate decisions

P21 Peptide Dosage Protocols for Research

Since p21 peptide is primarily used in cell culture and molecular biology studies, dosage guidelines focus on in vitro and in vivo experimental protocols.

General Dosage Guidelines

In Vitro Studies (Cell Culture)

Application	Concentration Range	Treatment Duration	Key Considerations
Cell cycle arrest	1-100 nM	24-72 hours	Monitor cell proliferation (e.g., BrdU incorporation, flow cytometry)
DNA damage response	10-200 nM	6-48 hours	Combine with DNA-damaging agents (e.g., doxorubicin, cisplatin)
Senescence induction	50-500 nM	3-7 days	Assess senescence markers (e.g., SA-β-gal, p16)
Stem cell differentiation	1-50 nM	3-14 days	Monitor differentiation markers (e.g., lineage-specific proteins)
Apoptosis modulation	10-200 nM	24-72 hours	Combine with apoptotic stimuli (e.g., staurosporine)

In Vivo Studies (Animal Models)

Application	Dosage Range	Administration Route	Frequency	Study Duration
Tumor suppression	1-10 mg/kg	Intraperitoneal (IP) or Intravenous (IV)	Daily or every other day	2-4 weeks
Chemotherapy enhancement	0.5-5 mg/kg	IP or IV	Before/after chemotherapy	1-2 weeks
Radiation therapy enhancement	1-10 mg/kg	IP or IV	Before/after radiation	1-2 weeks
Neuroprotection	0.1-1 mg/kg	IP or Intracerebroventricular (ICV)	Daily	1-4 weeks

Key Dosage Considerations

✔ Start with lower concentrations/doses to assess cellular responses
✔ Monitor cell cycle progression using flow cytometry or BrdU incorporation
✔ Combine with other treatments (e.g., chemotherapy, radiation) for synergistic effects
✔ Assess off-target effects on normal cells/tissues
✔ Optimize treatment timing based on experimental objectives

Potential Side Effects & Safety Considerations

While p21 peptide is generally well-tolerated in research, potential side effects should be monitored:

In Vitro Considerations

Potential Effect	Cause	Mitigation Strategy
Excessive cell cycle arrest	High p21 concentrations	Optimize dosage, monitor cell viability
Premature senescence	Prolonged p21 exposure	Limit treatment duration
Reduced cell proliferation	CDK inhibition	Use appropriate controls, monitor growth curves
Off-target effects	Non-specific protein interactions	Validate with p21-specific antibodies

In Vivo Considerations

Potential Effect	Cause	Mitigation Strategy
Immunogenicity	Foreign protein administration	Use species-specific p21, monitor immune response
Tissue toxicity	Off-target effects on normal cells	Optimize dosage, monitor organ function
Hematological effects	Bone marrow suppression	Monitor blood cell counts
Developmental effects	Cell cycle disruption in embryos	Avoid use in pregnant animals

Long-Term Considerations

⚠ Tumor suppression vs. promotion – P21 may promote tumor growth in certain contexts
⚠ Stem cell depletion – Prolonged p21 activation may reduce stem cell pools
⚠ Drug interactions – P21 may enhance or inhibit effects of chemotherapy/radiation
⚠ Species-specific effects – P21 function may vary between human and animal models

Where to Buy High-Quality P21 Peptide for Research

For researchers seeking high-purity p21 peptide, Wholesale China Peptides offers:
✅ ≥95% Purity (HPLC-verified)
✅ Recombinant expression for high biological activity
✅ Batch-specific COAs (Certificate of Analysis)
✅ Bulk & wholesale pricing for institutions
✅ Secure, discreet shipping worldwide
✅ Technical support for experimental design

Note: P21 peptide is for research use only—not for human consumption, medical treatment, or performance enhancement.

Conclusion: Why P21 Peptide is Essential for Cell Cycle & Cancer Research

P21 is a fundamental regulator of cell cycle progression, DNA damage response, and tumor suppression. Its ability to inhibit cyclin-dependent kinases, induce cell cycle arrest, and modulate cellular fate decisions makes it a valuable tool for studying:

✔ Cancer biology (tumor suppression, chemotherapy enhancement, metastasis prevention)
✔ Cell cycle regulation (G1/S and G2/M checkpoints, DNA damage response)
✔ Aging and senescence (cellular senescence, telomere dysfunction, oxidative stress)
✔ Stem cell biology (differentiation, self-renewal, reprogramming)
✔ Neurodegenerative diseases (Alzheimer’s, Parkinson’s, stroke, neurogenesis)

For researchers looking to advance cell cycle, cancer, and regenerative medicine studies, Wholesale China Peptides provides high-quality p21 peptide at competitive prices.

Disclaimer: This article is for educational and research purposes only. P21 peptide is not approved for human use and should only be used in IRB-approved laboratory settings.

Ready to Advance Your Cell Cycle & Cancer Research with P21 Peptide?
🔹 Visit Wholesale China Peptides
🔹 Request a COA before purchasing
🔹 Consult with our research team for experimental design support